PDB entry 1n4n

View 1n4n on RCSB PDB site
Description: Structure of the Plant Defensin PhD1 from Petunia Hybrida
Class: Plant protein
Keywords: Cysteine-stabilised alpha-beta motif, fifth disulfide bond
Deposited on 2002-11-01, released 2003-11-01
The last revision prior to the SCOP 1.73 freeze date was dated 2003-11-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: floral defensin-like protein 1
    Species: Petunia hybrida
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1n4na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4nA (A:)
    atckaecptwdsvcinkkpcvacckkakfsdghcskilrrclctkec