PDB entry 1n4n

View 1n4n on RCSB PDB site
Description: structure of the plant defensin phd1 from petunia hybrida
Deposited on 2002-11-01, released 2003-11-01
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-01, with a file datestamp of 2003-11-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1n4na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4nA (A:)
    atckaecptwdsvcinkkpcvacckkakfsdghcskilrrclctkec