PDB entry 1n4m

View 1n4m on RCSB PDB site
Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
Deposited on 2002-10-31, released 2003-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4mA (A:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
    aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
    slawlsdsplfdlikqsktregkstslslfykkvyrlaylrlntlcerllsehpelehii
    wtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfk
    rvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n4mB (B:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
    aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
    slawlsdsplfdlikqsktregkstslslfykkvyrlaylrlntlcerllsehpelehii
    wtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfk
    rvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4mB (B:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
    aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rsttdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawlsd
    splfdlikqsktregkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqht
    lqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikee
    eydsiivfynsvfmqrlktnilqyastrpptlspiphi