PDB entry 1n4m

View 1n4m on RCSB PDB site
Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
Class: Cell Cycle
Keywords: PROTEIN-PEPTIDE COMPLEX, Cell Cycle
Deposited on 2002-10-31, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoblastoma Pocket
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4M (0-344)
    Domains in SCOPe 2.07: d1n4ma1, d1n4ma2
  • Chain 'B':
    Compound: Retinoblastoma Pocket
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4M (0-344)
    Domains in SCOPe 2.07: d1n4mb1, d1n4mb2
  • Chain 'C':
    Compound: Transcription factor E2F2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transcription factor E2F2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transcription factor E2F2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4mA (A:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
    aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
    slawlsdsplfdlikqsktregkstslslfykkvyrlaylrlntlcerllsehpelehii
    wtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfk
    rvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n4mB (B:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
    aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
    slawlsdsplfdlikqsktregkstslslfykkvyrlaylrlntlcerllsehpelehii
    wtlfqhtlqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfk
    rvlikeeeydsiivfynsvfmqrlktnilqyastrpptlspiphi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4mB (B:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
    aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
    rsttdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawlsd
    splfdlikqsktregkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqht
    lqneyelmrdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikee
    eydsiivfynsvfmqrlktnilqyastrpptlspiphi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.