PDB entry 1n4l

View 1n4l on RCSB PDB site
Description: A DNA analogue of the polypurine tract of HIV-1
Class: transferase/DNA
Keywords: MMLV RT; Polypurine Tract; HIV-1; Asymmetric DNA; protein-DNA complex
Deposited on 2002-10-31, released 2003-06-24
The last revision prior to the SCOP 1.75 freeze date was dated 2003-07-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1n4la_
  • Chain 'B':
    Compound: 5'-d(*cp*tp*tp*tp*tp*tp*ap*ap*ap*ap*gp*ap*ap*ap*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*tp*tp*tp*cp*tp*tp*tp*tp*ap*ap*ap*ap*ap*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n4lA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    No sequence available.