PDB entry 1n4k

View 1n4k on RCSB PDB site
Description: Crystal structure of the inositol 1,4,5-trisphosphate receptor binding core in complex with IP3
Class: membrane protein
Keywords: ip3 receptor, ip3-binding core, calcium channel,protein-ligand complex, b-trefoil fold, armadillo-like fold, membrane protein
Deposited on 2002-10-31, released 2002-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol 1,4,5-trisphosphate receptor type 1
    Species: Mus musculus [TaxId:10090]
    Gene: ITPR1 OR INSP3R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4ka1, d1n4ka2
  • Heterogens: I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n4kA (A:)
    mkwsdnkddilkggdvvrlfhaeqekfltcdehrkkqhvflrttgrqsatsatsskalwe
    vevvqhdpcrggagywnslfrfkhlatghylaaevdpdfeeeclefqpsvdpdqdasrsr
    lrnaqekmvyslvsvpegndissifeldpttlrggdslvprnsyvrlrhlctntwvhstn
    ipidkeeekpvmlkigtsplkedkeafaivpvspaevrdldfandaskvlgsiagklekg
    titqnerrsvtklledlvyfvtggtnsgqdvlevvfskpnrerqklmreqnilkqifkll
    qapftdcgdgpmlrleelgdqrhapfrhicrlcyrvlrhsqqdyrknqeyiakqfgfmqk
    qigydvlaedtitallhnnrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4kA (A:)
    ggdvvrlfhaeqekfltcdehrkkqhvflrttgrqsatsatsskalwevevvqlfrfkhl
    atghylaaevdmvyslvsvpegndissifeldpyvrlrhlctntwvhstnipidkeeekp
    vmlkigtsplkedkeafaivpvspaevrdldfandaskvlgsiagklekgtitqnerrsv
    tklledlvyfvtggtnsgqdvlevvfskpnrerqklmreqnilkqifkllqapfthapfr
    hicrlcyrvlrhsqqdyrknqeyiakqfgfmqkqigydvlaedtitallhnn