PDB entry 1n4a

View 1n4a on RCSB PDB site
Description: The Ligand Bound Structure of E.coli BtuF, the Periplasmic Binding Protein for Vitamin B12
Class: transport protein
Keywords: ABC transporter, periplasmic binding protein, Vitamin B12, transmembrane transport, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSPORT PROTEIN
Deposited on 2002-10-30, released 2003-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12 transport protein btuF
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37028
      • modified residue (46)
      • modified residue (82)
    Domains in SCOPe 2.05: d1n4aa_
  • Chain 'B':
    Compound: Vitamin B12 transport protein btuF
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37028 (0-243)
      • modified residue (46)
      • modified residue (82)
    Domains in SCOPe 2.05: d1n4ab_
  • Heterogens: CNC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n4aA (A:)
    aprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdlv
    iawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldq
    yaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsre
    qvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcnal
    sqvdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4aA (A:)
    aprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdlv
    iawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldq
    yaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsre
    qvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcnal
    sqvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n4aB (B:)
    aprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdlv
    iawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldq
    yaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsre
    qvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcnal
    sqvdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4aB (B:)
    aprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdlv
    iawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldq
    yaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsre
    qvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcnal
    sqvd