PDB entry 1n47

View 1n47 on RCSB PDB site
Description: Isolectin B4 from Vicia villosa in complex with the Tn antigen
Class: sugar binding protein
Keywords: cancer antigen, Vicia villosa lectin, glycoprotein Tn-binding protein, carbohydrate recognition
Deposited on 2002-10-30, released 2003-02-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-02-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isolectin B4
    Species: Vicia villosa
    Domains in SCOP 1.73: d1n47a_
  • Chain 'B':
    Compound: Isolectin B4
    Species: Vicia villosa
    Domains in SCOP 1.73: d1n47b_
  • Chain 'C':
    Compound: Isolectin B4
    Species: Vicia villosa
    Domains in SCOP 1.73: d1n47c_
  • Chain 'D':
    Compound: Isolectin B4
    Species: Vicia villosa
    Domains in SCOP 1.73: d1n47d_
  • Heterogens: CA, MN, TNR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n47A (A:)
    testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
    nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
    avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
    pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n47B (B:)
    testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
    nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
    avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
    pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n47C (C:)
    testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
    nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
    avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
    pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n47D (D:)
    testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
    nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
    avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
    pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla