PDB entry 1n40

View 1n40 on RCSB PDB site
Description: Atomic structure of CYP121, a mycobacterial P450
Class: oxidoreductase
Keywords: heme binding, oxygen binding, P450 fold, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2002-10-30, released 2003-02-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.134
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 121
    Species: Mycobacterium tuberculosis
    Gene: CYP121 OR RV2276 OR MT2336 OR MTCY339.34C
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1n40a_
  • Heterogens: SO4, HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n40A (A:)
    mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrf
    smketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansl
    ldnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaaki
    nwdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgs
    flttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvr
    kgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigie
    allkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n40A (A:)
    tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
    mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
    dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
    wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsf
    lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
    gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
    llkkmpgvdlavpidqlvwrtrfqrriperlpvlw