PDB entry 1n3z

View 1n3z on RCSB PDB site
Description: Crystal structure of the [S-carboxyamidomethyl-Cys31, S-carboxyamidomethyl-Cys32] monomeric derivative of the bovine seminal ribonuclease in the liganded state
Class: hydrolase
Keywords: Protein-nucleotide complex, HYDROLASE
Deposited on 2002-10-30, released 2003-08-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease, seminal
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1n3za_
  • Heterogens: U3P, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1n3zA (A:)
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

    Sequence, based on observed residues (ATOM records): (download) 
    >1n3zA (A:)
kesaaakferqhmdsgssnycnlmmccrkmtqgkckpvntfvhesladvkavcsqkkvtc
kngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhfdasv