PDB entry 1n3o

View 1n3o on RCSB PDB site
Description: Pterocarcpus angolensis lectin in complex with alpha-methyl glucose
Deposited on 2002-10-29, released 2002-11-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-20, with a file datestamp of 2002-11-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n3oa_
  • Chain 'B':
    Domains in SCOP 1.63: d1n3ob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n3oA (A:)
    qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n3oB (B:)
    qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
    ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
    anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
    rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
    a