PDB entry 1n3j

View 1n3j on RCSB PDB site
Description: Structure and Substrate of a Histone H3 Lysine Methyltransferase from Paramecium Bursaria Chlorella Virus 1
Class: transferase
Keywords: Beta barrel, homodimer, TRANSFERASE
Deposited on 2002-10-28, released 2003-01-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Histone H3 Lysine Methyltransferase
  Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
  Gene: A612L
  Database cross-references and differences (RAF-indexed):
  • Uniprot O41094 (0-118)
  Domains in SCOPe 2.04: d1n3ja_
• Chain 'B':
  Compound: Histone H3 Lysine Methyltransferase
  Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
  Gene: A612L
  Database cross-references and differences (RAF-indexed):
  • Uniprot O41094 (0-118)
  Domains in SCOPe 2.04: d1n3jb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n3jA (A:)
  mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
  algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n3jB (B:)
  mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
  algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn