PDB entry 1n3j

View 1n3j on RCSB PDB site
Description: structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1
Deposited on 2002-10-28, released 2003-01-28
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-28, with a file datestamp of 2003-01-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n3ja_
  • Chain 'B':
    Domains in SCOP 1.63: d1n3jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n3jA (A:)
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n3jB (B:)
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn