PDB entry 1n3j

View 1n3j on RCSB PDB site
Description: Structure and Substrate of a Histone H3 Lysine Methyltransferase from Paramecium Bursaria Chlorella Virus 1
Class: transferase
Keywords: Beta barrel, homodimer, TRANSFERASE
Deposited on 2002-10-28, released 2003-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3 Lysine Methyltransferase
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Gene: A612L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n3ja_
  • Chain 'B':
    Compound: Histone H3 Lysine Methyltransferase
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Gene: A612L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n3jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n3jA (A:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n3jB (B:)
    mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
    algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn