PDB entry 1n3i

View 1n3i on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis pnp with transition state analog dadme-immh
Deposited on 2002-10-28, released 2003-09-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1n3ia_
  • Chain 'B':
    Domains in SCOP 1.67: d1n3ib_
  • Chain 'C':
    Domains in SCOP 1.67: d1n3ic_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n3iA (A:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3iA (A:)
    dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
    ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
    dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
    hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
    laagaasatrmgalladviarf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n3iB (B:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3iB (B:)
    dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
    ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
    dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
    hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
    laagaasatrmgalladviarf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n3iC (C:)
    madprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgf
    vpptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltna
    agglradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvy
    aglpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgep
    lshaevlaagaasatrmgalladviarf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3iC (C:)
    dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
    ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
    dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
    hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
    laagaasatrmgalladviarf