PDB entry 1n3h

View 1n3h on RCSB PDB site
Description: Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
Class: signaling protein
Keywords: Free Protein, Beta Sandwich, SIGNALING PROTEIN
Deposited on 2002-10-28, released 2003-10-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SHC Transforming protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Shc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1n3ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n3hA (A:)
mnklsggggrrtrveggqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcv
evlqsmraldfntrtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagm
pitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachil
ecpeglaqdvistigqafelrfkqylr