PDB entry 1n3h

View 1n3h on RCSB PDB site
Description: coupling of folding and binding in the ptb domain of the signaling protein shc
Deposited on 2002-10-28, released 2003-10-28
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-28, with a file datestamp of 2003-10-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1n3ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n3hA (A:)
mnklsggggrrtrveggqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcv
evlqsmraldfntrtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagm
pitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachil
ecpeglaqdvistigqafelrfkqylr