PDB entry 1n3g

View 1n3g on RCSB PDB site
Description: Solution structure of the ribosome-associated cold shock response protein Yfia of Escherichia coli
Class: translation
Keywords: cold shock, translation inhibitor, dsRBD
Deposited on 2002-10-28, released 2003-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein yfiA
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AD49 (0-112)
  Domains in SCOPe 2.08: d1n3ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n3gA (A:)
  mtmnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngv
  lvasgkhedmytainelinklerqlnklqhkgearraatsvkdanfveeveee