PDB entry 1n3e

View 1n3e on RCSB PDB site
Description: Crystal structure of I-CreI bound to a palindromic DNA sequence I (palindrome of left side of wildtype DNA target sequence)
Deposited on 2002-10-28, released 2003-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-03, with a file datestamp of 2003-06-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1n3ea_
  • Chain 'B':
    Domains in SCOP 1.71: d1n3eb_
  • Chain 'G':
    Domains in SCOP 1.71: d1n3eg_
  • Chain 'H':
    Domains in SCOP 1.71: d1n3eh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n3eA (A:)
    mntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3eA (A:)
    tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
    gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
    levctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n3eB (B:)
    mntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3eB (B:)
    tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
    gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
    levctwvdqiaalndsktrkttsetvravld
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1n3eG (G:)
    mntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3eG (G:)
    tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
    gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
    levctwvdqiaalndsktrkttsetvravld
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1n3eH (H:)
    mntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvd
    eigvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespd
    kflevctwvdqiaalndsktrkttsetvravldslsekkkssp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3eH (H:)
    tkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvdei
    gvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdkf
    levctwvdqiaalndsktrkttsetvravld