PDB entry 1n3c

View 1n3c on RCSB PDB site
Description: Structural and biochemical exploration of a critical amino acid in human 8-oxoguanine glycosylase
Class: hydrolase, lyase/DNA
Keywords: HhH-GPD DNA glycosylase DNA repair oxoguanine, hydrolase, lyase/DNA COMPLEX
Deposited on 2002-10-25, released 2003-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (3-316)
      • cloning artifact (0-2)
      • engineered (259)
    Domains in SCOPe 2.06: d1n3ca1, d1n3ca2, d1n3ca3
  • Chain 'B':
    Compound: DNA complement strand
  • Chain 'C':
    Compound: 8-oxoG-containing DNA
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n3cA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
    gvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqala
    gpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgt
    kvadciclmaldkpqavpvnvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwg
    pyagwaqavlfsadlrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n3cA (A:)
    gseghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkva
    dciclmaldkpqavpvnvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.