PDB entry 1n31

View 1n31 on RCSB PDB site
Description: Structure of A Catalytically Inactive Mutant (K223A) of C-DES with a Substrate (Cystine) Linked to the Co-Factor
Class: lyase
Keywords: inactive mutant, substrate complex, FE-S cluster synthesis, NifS-like, LYASE
Deposited on 2002-10-25, released 2003-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-cysteine/cystine lyase C-DES
    Species: Synechocystis sp. PCC 6714 [TaxId:1147]
    Gene: C-DES
    Database cross-references and differences (RAF-indexed):
    • GB AAD02935 (1-385)
      • cloning artifact (0)
      • engineered (215)
    Domains in SCOPe 2.07: d1n31a1, d1n31a2
  • Chain 'B':
    Compound: L-cysteine/cystine lyase C-DES
    Species: Synechocystis sp. PCC 6714 [TaxId:1147]
    Gene: C-DES
    Database cross-references and differences (RAF-indexed):
    • GB AAD02935 (1-385)
      • cloning artifact (0)
      • engineered (215)
    Domains in SCOPe 2.07: d1n31b1, d1n31b2
  • Heterogens: K, PLP, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n31A (A:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfgp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n31B (B:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfgp