PDB entry 1n2z

View 1n2z on RCSB PDB site
Description: 2.0 Angstrom structure of BtuF, the vitamin B12 binding protein of E. coli
Class: transport protein
Keywords: transport protein
Deposited on 2002-10-24, released 2002-12-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12 transport protein btuF
    Species: Escherichia coli [TaxId:562]
    Gene: btuf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1n2za_
  • Chain 'B':
    Compound: Vitamin B12 transport protein btuF
    Species: Escherichia coli [TaxId:562]
    Gene: btuf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1n2zb_
  • Heterogens: CD, CL, CNC, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n2zA (A:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n2zB (B:)
    aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
    viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
    qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
    eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
    lsqvd