PDB entry 1n2u

View 1n2u on RCSB PDB site
Description: Structure and Mechanism of Action of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: complex with the bromohydrine of IPP
Class: isomerase
Keywords: complex
Deposited on 2002-10-24, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-08-26, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isopentenyl diphosphate delta-isomerase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822
      • engineered (66)
    Domains in SCOPe 2.07: d1n2ua_
  • Chain 'B':
    Compound: isopentenyl diphosphate delta-isomerase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822 (Start-181)
      • engineered (66)
      • cloning artifact (182)
    Domains in SCOPe 2.07: d1n2ub1, d1n2ub2
  • Heterogens: MN, MG, BHI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n2uA (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n2uA (A:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n2uB (B:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n2uB (B:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl