PDB entry 1n2t

View 1n2t on RCSB PDB site
Description: C-DES Mutant K223A with GLY Covalenty Linked to the PLP-cofactor
Class: lyase
Keywords: fes cluster biosynthesis, nifs, pyridoxal 5'-phosphate, inactive mutant
Deposited on 2002-10-24, released 2003-01-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-21, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-cysteine/cystine lyase C-DES
    Species: Synechocystis sp. PCC 6714
    Gene: C-DES
    Database cross-references and differences (RAF-indexed):
    • GB AAD02935 (1-End)
      • cloning artifact (0)
      • engineered (215)
    Domains in SCOP 1.73: d1n2ta_
  • Chain 'B':
    Compound: L-cysteine/cystine lyase C-DES
    Species: Synechocystis sp. PCC 6714
    Gene: C-DES
    Database cross-references and differences (RAF-indexed):
    • GB AAD02935 (1-End)
      • cloning artifact (0)
      • engineered (215)
    Domains in SCOP 1.73: d1n2tb_
  • Heterogens: K, PLP, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n2tA (A:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n2tA (A:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n2tB (B:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n2tB (B:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfg