PDB entry 1n2t

View 1n2t on RCSB PDB site
Description: c-des mutant k223a with gly covalenty linked to the plp-cofactor
Deposited on 2002-10-24, released 2003-01-21
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-21, with a file datestamp of 2003-01-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n2ta_
  • Chain 'B':
    Domains in SCOP 1.63: d1n2tb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n2tA (A:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n2tB (B:)
    tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
    rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
    fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
    gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
    yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
    rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
    iracchyitdeeeinhllarladfg