PDB entry 1n2s

View 1n2s on RCSB PDB site
Description: crystal structure of dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) in complex with nadh
Class: oxidoreductase
Keywords: rossman-fold, sugar-nucleotide-binding domain, oxidoreductase
Deposited on 2002-10-24, released 2002-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dTDP-glucose oxidoreductase
    Species: Salmonella enterica [TaxId:90371]
    Gene: rfbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n2sa_
  • Heterogens: MG, NAI, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n2sA (A:)
    mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
    aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
    atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
    dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
    laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n2sA (A:)
    mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
    aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
    atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
    dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
    laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt