PDB entry 1n28

View 1n28 on RCSB PDB site
Description: Crystal structure of the H48Q mutant of human group IIA phospholipase A2
Class: hydrolase
Keywords: hydrolase
Deposited on 2002-10-22, released 2003-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.184
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2, membrane associated
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14555 (0-123)
      • engineered (0)
      • engineered (46)
    Domains in SCOPe 2.06: d1n28a_
  • Chain 'B':
    Compound: Phospholipase A2, membrane associated
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14555 (0-123)
      • engineered (0)
      • engineered (46)
    Domains in SCOPe 2.06: d1n28b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n28A (A:)
    alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvtqdccykrlekrgcg
    tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
    tprc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n28B (B:)
    alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvtqdccykrlekrgcg
    tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
    tprc