PDB entry 1n1y

View 1n1y on RCSB PDB site
Description: Trypanosoma rangeli sialidase in complex with sialic acid
Class: Hydrolase
Keywords: BETA PROPELLER, LECTIN-LIKE FOLD, Hydrolase
Deposited on 2002-10-21, released 2003-01-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli [TaxId:5698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44049 (3-End)
      • cloning artifact (0-2)
      • see remark 999 (52)
      • see remark 999 (179)
      • see remark 999 (188)
      • see remark 999 (374)
      • see remark 999 (608)
    Domains in SCOPe 2.03: d1n1ya1, d1n1ya2
  • Heterogens: SIA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n1yA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatppskggcgaavpt
    aglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryq
    fanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapaspt
    gswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgapt
    dsrvtvtnvvlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1yA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpagcgaavptaglvgf
    lshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfanyrf
    tlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgswelh
    kkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptdsrvtv
    tnvvlynrrlnsseirtlflsqdmigtd