PDB entry 1n1y

View 1n1y on RCSB PDB site
Description: trypanosoma rangeli sialidase in complex with sialic acid
Deposited on 2002-10-21, released 2003-01-07
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n1yA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatppskggcgaavpt
    aglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryq
    fanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapaspt
    gswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgapt
    dsrvtvtnvvlynrrlnsseirtlflsqdmigtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1yA (A:)
    aaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryet
    sfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnkt
    rnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefv
    ggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlew
    egkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtieg
    krvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslh
    eintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpagcgaavptaglvgf
    lshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfanyrf
    tlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgswelh
    kkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptdsrvtv
    tnvvlynrrlnsseirtlflsqdmigtd