PDB entry 1n1q

View 1n1q on RCSB PDB site
Description: Crystal structure of a Dps protein from Bacillus brevis
Class: unknown function
Keywords: four-helix bundle, UNKNOWN FUNCTION
Deposited on 2002-10-19, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DPS Protein
    Species: Brevibacillus brevis [TaxId:1393]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n1qa_
  • Chain 'B':
    Compound: DPS Protein
    Species: Brevibacillus brevis [TaxId:1393]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n1qb_
  • Chain 'C':
    Compound: DPS Protein
    Species: Brevibacillus brevis [TaxId:1393]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n1qc_
  • Chain 'D':
    Compound: DPS Protein
    Species: Brevibacillus brevis [TaxId:1393]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n1qd_
  • Heterogens: FEO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1qA (A:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1qB (B:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n1qC (C:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1qC (C:)
    siqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtlaer
    vlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvadeadd
    eatadmldaieaglekhvwmleafle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n1qD (D:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1qD (D:)
    qqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtlaervl
    siggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvadeaddea
    tadmldaieaglekhvwmleafle