PDB entry 1n1q

View 1n1q on RCSB PDB site
Description: crystal structure of a dps protein from bacillus brevis
Deposited on 2002-10-19, released 2003-05-27
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1n1qa_
  • Chain 'B':
    Domains in SCOP 1.69: d1n1qb_
  • Chain 'C':
    Domains in SCOP 1.69: d1n1qc_
  • Chain 'D':
    Domains in SCOP 1.69: d1n1qd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1qA (A:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n1qB (B:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n1qC (C:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1qC (C:)
    siqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtlaer
    vlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvadeadd
    eatadmldaieaglekhvwmleafle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n1qD (D:)
    mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
    aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
    addeatadmldaieaglekhvwmleafle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1qD (D:)
    qqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtlaervl
    siggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvadeaddea
    tadmldaieaglekhvwmleafle