PDB entry 1n1i

View 1n1i on RCSB PDB site
Description: The structure of MSP-1(19) from Plasmodium knowlesi
Class: cell adhesion
Keywords: MSP1, malaria, surface protein, surface antigen, glycoprotein, EGF domain, CELL ADHESION
Deposited on 2002-10-17, released 2003-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Merozoite surface protein-1
    Species: Plasmodium knowlesi strain H [TaxId:5851]
    Gene: MSP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GSQ9 (Start-96)
      • expression tag (97)
    Domains in SCOPe 2.07: d1n1ia1, d1n1ia2, d1n1ia3
  • Chain 'B':
    Compound: Merozoite surface protein-1
    Species: Plasmodium knowlesi strain H [TaxId:5851]
    Gene: MSP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GSQ9 (Start-96)
      • expression tag (97-99)
    Domains in SCOPe 2.07: d1n1ib1, d1n1ib2, d1n1ib3
  • Chain 'C':
    Compound: Merozoite surface protein-1
    Species: Plasmodium knowlesi strain H [TaxId:5851]
    Gene: MSP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GSQ9 (Start-96)
      • expression tag (97-100)
    Domains in SCOPe 2.07: d1n1ic1, d1n1ic2, d1n1ic3
  • Chain 'D':
    Compound: Merozoite surface protein-1
    Species: Plasmodium knowlesi strain H [TaxId:5851]
    Gene: MSP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n1id1, d1n1id2
  • Heterogens: IMD, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n1iA (A:)
    eaeasnmssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceenngg
    capeaectmddkkeveckctkegseplfegvfcssssgphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1iA (A:)
    ssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaec
    tmddkkeveckctkegseplfegvfcssssg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n1iB (B:)
    eaeasnmssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceenngg
    capeaectmddkkeveckctkegseplfegvfcssssgphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1iB (B:)
    ssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaec
    tmddkkeveckctkegseplfegvfcssssgph
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n1iC (C:)
    eaeasnmssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceenngg
    capeaectmddkkeveckctkegseplfegvfcssssgphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1iC (C:)
    sahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaect
    mddkkeveckctkegseplfegvfcssssgphh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n1iD (D:)
    eaeasnmssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceenngg
    capeaectmddkkeveckctkegseplfegvfcssssgphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1iD (D:)
    ssahkcidtnvpenaacyryldgteewrcllgfkevggkcvpasitceennggcapeaec
    tmddkkeveckctkegseplfegvfcs