PDB entry 1n1d

View 1n1d on RCSB PDB site
Description: Glycerol-3-phosphate cytidylyltransferase complexed with CDP-glycerol
Class: transferase
Keywords: alpha/beta fold, cytidylyltransferase, nucleotidyltransferase, negative cooperativity, CDP-glycerol
Deposited on 2002-10-17, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate cytidylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n1da_
  • Chain 'B':
    Compound: glycerol-3-phosphate cytidylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n1db_
  • Chain 'C':
    Compound: glycerol-3-phosphate cytidylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n1dc_
  • Chain 'D':
    Compound: glycerol-3-phosphate cytidylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n1dd_
  • Heterogens: SO4, C2G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n1dA (A:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeeiagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1dA (A:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n1dB (B:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeeiagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1dB (B:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n1dC (C:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeeiagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1dC (C:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n1dD (D:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeeiagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1dD (D:)
    mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
    tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
    kikeei