PDB entry 1n1c

View 1n1c on RCSB PDB site
Description: Crystal Structure Of The Dimeric TorD Chaperone From Shewanella Massilia
Class: chaperone
Keywords: CHAPERONE, TORD, 3D-domain swapping
Deposited on 2002-10-17, released 2003-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TorA specific chaperone
    Species: Shewanella massilia [TaxId:76854]
    Gene: torD
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87949 (Start-208)
      • engineered (7)
      • modified residue (113)
      • modified residue (138)
      • modified residue (142)
      • engineered (146)
      • engineered (162)
      • expression tag (209)
    Domains in SCOPe 2.07: d1n1ca1, d1n1ca2
  • Chain 'B':
    Compound: TorA specific chaperone
    Species: Shewanella massilia [TaxId:76854]
    Gene: torD
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87949 (Start-208)
      • engineered (7)
      • modified residue (113)
      • modified residue (138)
      • modified residue (142)
      • engineered (146)
      • engineered (162)
      • expression tag (209-213)
    Domains in SCOPe 2.07: d1n1cb1, d1n1cb2
  • Heterogens: DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n1cA (A:)
    msqvdinparalvyqllsslfarevdeqrlkeltseaaqqfweqlsleanftqsvdkirs
    tlngikddeallelaadycglflvgtkhsaspyaslylsgedepllfgeqhqqmseflhq
    sklqvqshfpepadhlavmlaymahlcchsensvqlsflqtcvnswlakfinhltqcnkn
    gfysavatltlawvkqdiaqlepavaiislehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1cA (A:)
    vdinparalvyqllsslfarevdeqrlkeltseaaqqfweqlsleanftqsvdkirstln
    gikddeallelaadycglflvgtsaspyaslylllfgeqhqqmseflhqsklqvqshfpe
    padhlavmlaymahlcchsensvqlsflqtcvnswlakfinhltqcnkngfysavatltl
    awvkqdiaqlepavaiisl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n1cB (B:)
    msqvdinparalvyqllsslfarevdeqrlkeltseaaqqfweqlsleanftqsvdkirs
    tlngikddeallelaadycglflvgtkhsaspyaslylsgedepllfgeqhqqmseflhq
    sklqvqshfpepadhlavmlaymahlcchsensvqlsflqtcvnswlakfinhltqcnkn
    gfysavatltlawvkqdiaqlepavaiislehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n1cB (B:)
    dinparalvyqllsslfarevdeqrlkeltseaaqqfweqlsleanftqsvdkirstlng
    ikddeallelaadycglflvgsaspyaslylgeqhqqmseflhqsklqvqshfpepadhl
    avmlaymahlcchsensvqlsflqtcvnswlakfinhltqcnkngfysavatltlawvkq
    diaqlepavaiislehhh