PDB entry 1n12
View 1n12 on RCSB PDB site
Description: Crystal structure of the PapE (N-terminal-deleted) pilus subunit bound to a peptide corresponding to the N-terminal extension of the PapK pilus subunit (residues 1-11) from uropathogenic E. coli
Class: chaperone
Keywords: Immunoglobulin-like fold, donor strand complementation, donor strand exchange, chaperone priming, pilus fiber assembly, organelle biogenesis
Deposited on
2002-10-16, released
2002-12-11
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.208
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: mature Fimbrial protein PapE
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P08407 (0-126)
- modified residue (34)
- modified residue (43)
- modified residue (118)
Domains in SCOPe 2.03: d1n12a_ - Chain 'B':
Compound: Peptide corresponding to the N-terminal extension of protein PapK
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: mature Fimbrial protein PapE
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
- Uniprot P08407 (0-126)
- modified residue (34)
- modified residue (43)
- modified residue (118)
Domains in SCOPe 2.03: d1n12c_ - Chain 'D':
Compound: Peptide corresponding to the N-terminal extension of protein PapK
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1n12A (A:)
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1n12C (C:)
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys
Sequence, based on observed residues (ATOM records): (download)
>1n12C (C:)
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmqnl
iagpfsatatlvasys
- Chain 'D':
No sequence available.