PDB entry 1n12

View 1n12 on RCSB PDB site
Description: Crystal structure of the PapE (N-terminal-deleted) pilus subunit bound to a peptide corresponding to the N-terminal extension of the PapK pilus subunit (residues 1-11) from uropathogenic E. coli
Class: chaperone
Keywords: Immunoglobulin-like fold, donor strand complementation, donor strand exchange, chaperone priming, pilus fiber assembly, organelle biogenesis
Deposited on 2002-10-16, released 2002-12-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mature Fimbrial protein PapE
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08407 (0-126)
      • modified residue (34)
      • modified residue (43)
      • modified residue (118)
    Domains in SCOPe 2.03: d1n12a_
  • Chain 'B':
    Compound: Peptide corresponding to the N-terminal extension of protein PapK
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: mature Fimbrial protein PapE
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08407 (0-126)
      • modified residue (34)
      • modified residue (43)
      • modified residue (118)
    Domains in SCOPe 2.03: d1n12c_
  • Chain 'D':
    Compound: Peptide corresponding to the N-terminal extension of protein PapK
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n12A (A:)
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1n12C (C:)
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
nliagpfsatatlvasys

    Sequence, based on observed residues (ATOM records): (download) 
    >1n12C (C:)
vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
qntsntdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmqnl
iagpfsatatlvasys

  • Chain 'D':
    No sequence available.