PDB entry 1n12

View 1n12 on RCSB PDB site
Description: Crystal structure of the PapE (N-terminal-deleted) pilus subunit bound to a peptide corresponding to the N-terminal extension of the PapK pilus subunit (residues 1-11) from uropathogenic E. coli
Class: chaperone
Keywords: Immunoglobulin-like fold, donor strand complementation, donor strand exchange, chaperone priming, pilus fiber assembly, organelle biogenesis
Deposited on 2002-10-16, released 2002-12-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mature Fimbrial protein PapE
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08407 (0-126)
    • modified residue (34)
    • modified residue (43)
    • modified residue (118)
  Domains in SCOPe 2.01: d1n12a_
• Chain 'B':
  Compound: Peptide corresponding to the N-terminal extension of protein PapK
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42190 (0-10)
• Chain 'C':
  Compound: mature Fimbrial protein PapE
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08407 (0-126)
    • modified residue (34)
    • modified residue (43)
    • modified residue (118)
  Domains in SCOPe 2.01: d1n12c_
• Chain 'D':
  Compound: Peptide corresponding to the N-terminal extension of protein PapK
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42190 (0-10)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n12A (A:)
  vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
  qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
  nliagpfsatatlvasys
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >1n12C (C:)
  vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
  qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
  nliagpfsatatlvasys
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1n12C (C:)
  vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
  qntsntdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmqnl
  iagpfsatatlvasys
  

  
  
• Chain 'D':
  No sequence available.