PDB entry 1n10

View 1n10 on RCSB PDB site
Description: Crystal Structure of Phl p 1, a Major Timothy Grass Pollen Allergen
Class: allergen
Keywords: Plant allergen, phl p 1, expansin, immunoglobulin-like fold, double-psi beta barrel, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ALLERGEN
Deposited on 2002-10-16, released 2003-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pollen allergen Phl p 1
    Species: Phleum pratense [TaxId:15957]
    Gene: PHLPI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n10a1, d1n10a2
  • Chain 'B':
    Compound: Pollen allergen Phl p 1
    Species: Phleum pratense [TaxId:15957]
    Gene: PHLPI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n10b1, d1n10b2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n10A (A:)
    aipkvppgpnitatygdkwldakstwygkptgagpkdnggacgykdvdkppfsgmtgcgn
    tpifksgrgcgscfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkg
    deqklrsagelelqfrrvkckypegtkvtfhvekgsnpnylallvkyvngdgdvvavdik
    ekgkdkwielkeswgaiwridtpdkltgpftvrytteggtkteaedvipegwkadtsyes
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n10A (A:)
    pkvppgpnitatygdkwldakstwygggacgykdvdkppfsgmtgcgntpifksgrgcgs
    cfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkgdeqklrsagele
    lqfrrvkckypegtkvtfhvekgsnpnylallvkyvngdgdvvavdikekgkdkwielke
    swgaiwridtpdkltgpftvrytteggtkteaedvipegwkadtsyes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n10B (B:)
    aipkvppgpnitatygdkwldakstwygkptgagpkdnggacgykdvdkppfsgmtgcgn
    tpifksgrgcgscfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkg
    deqklrsagelelqfrrvkckypegtkvtfhvekgsnpnylallvkyvngdgdvvavdik
    ekgkdkwielkeswgaiwridtpdkltgpftvrytteggtkteaedvipegwkadtsyes
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n10B (B:)
    pkvppgpnitatygdkwldakstwygggacgykdvdkppfsgmtgcgntpifksgrgcgs
    cfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgamakkgdeqklrsagele
    lqfrrvkckypegtkvtfhvekgsnpnylallvkyvngdgdvvavdikekgkdkwielke
    swgaiwridtpdkltgpftvrytteggtkteaedvipegwkadtsyes