PDB entry 1n0x

View 1n0x on RCSB PDB site
Description:
Deposited on 2002-10-15, released 2004-04-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1n0xh1, d1n0xh2
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1n0xk1, d1n0xk2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1n0xl1, d1n0xl2
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1n0xm1, d1n0xm2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1n0xH (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0xH (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1n0xK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0xK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n0xL (L:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n0xM (M:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec