PDB entry 1n0x

View 1n0x on RCSB PDB site
Description: Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
Class: immune system
Keywords: antibody-peptide complex, peptide dimer, IMMUNE SYSTEM
Deposited on 2002-10-15, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N0X (0-123)
    • Uniprot P0DOX5 (124-End)
    Domains in SCOPe 2.07: d1n0xh1, d1n0xh2
  • Chain 'K':
    Compound: immunoglobulin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N0X (0-123)
    • Uniprot P0DOX5 (124-229)
    Domains in SCOPe 2.07: d1n0xk1, d1n0xk2
  • Chain 'L':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N0X (0-106)
    • Uniprot Q8TCD0 (107-214)
      • conflict (202)
    Domains in SCOPe 2.07: d1n0xl1, d1n0xl2
  • Chain 'M':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N0X (0-106)
    • Uniprot Q8TCD0 (107-214)
      • conflict (202)
    Domains in SCOPe 2.07: d1n0xm1, d1n0xm2
  • Chain 'P':
    Compound: B2.1 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N0X (0-20)
  • Chain 'R':
    Compound: B2.1 peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N0X (0-End)
  • Heterogens: GOL, SO4, CXS, K, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1n0xH (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0xH (H:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1n0xK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0xK (K:)
    qvqlvqsgaevkkpgasvkvscqasgyrfsnfvihwvrqapgqrfewmgwinpyngnkef
    sakfqdrvtftadtsantaymelrslrsadtavyycarvgpyswddspqdnyymdvwgkg
    ttvivssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n0xL (L:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n0xM (M:)
    eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
    drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerkrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'P':
    No sequence available.

  • Chain 'R':
    No sequence available.