PDB entry 1n0w

View 1n0w on RCSB PDB site
Description: crystal structure of a rad51-brca2 brc repeat complex
Deposited on 2002-10-15, released 2002-11-27
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1n0wa_
  • Chain 'B':
    Domains in SCOP 1.69: d1n0wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0wA (A:)
    seiiqittgskeldkllqggietgsitemfgefrtgktqichtlavtcqlpidrgggegk
    amyidtegtfrperllavaeryglsgsdvldnvayarafntdhqtqllyqasammvesry
    allivdsatalyrtdysgrgelsarqmhlarflrmllrladefgvavvitnqvvaqvdga
    amfaadpkkpiggniiahasttrlylrkgrgetrickiydspclpeaeamfainadgvgd
    akd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0wA (A:)
    eiiqittgskeldkllqggietgsitemfgefrtgktqichtlavtcqlpidrgggegka
    myidtegtfrperllavaeryglsgsdvldnvayarafntdhqtqllyqasammvesrya
    llivdsatalyrelsarqmhlarflrmllrladefgvavvitnahasttrlylrkgrget
    rickiydspclpeaeamfainadgvgdakd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n0wB (B:)
    keptllgfhtasgkkvkiakesldkvknlfdekeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0wB (B:)
    ptllgfhtasgkkvkiakesldkvknlfdekeq