PDB entry 1n0l

View 1n0l on RCSB PDB site
Description: Crystal structure of the PapD chaperone (C-terminally 6x histidine-tagged) bound to the PapE pilus subunit (N-terminal-deleted) from uropathogenic E. coli
Class: chaperone
Keywords: Immunoglobulin-like fold, donor strand complemenation, donor strand exchange, chaperone priming, pilus fiber assembly
Deposited on 2002-10-14, released 2002-12-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein papd
    Species: Escherichia coli [TaxId:562]
    Gene: papD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15319 (0-End)
      • modified residue (17)
      • modified residue (65)
      • modified residue (171)
    Domains in SCOPe 2.01: d1n0la1, d1n0la2
  • Chain 'B':
    Compound: mature Fimbrial protein PapE
    Species: Escherichia coli [TaxId:562]
    Gene: papE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08407 (0-126)
      • modified residue (34)
      • modified residue (43)
    Domains in SCOPe 2.01: d1n0lb_
  • Chain 'C':
    Compound: chaperone protein papd
    Species: Escherichia coli [TaxId:562]
    Gene: papD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15319 (0-End)
      • modified residue (17)
      • modified residue (65)
      • modified residue (171)
    Domains in SCOPe 2.01: d1n0lc1, d1n0lc2
  • Chain 'D':
    Compound: mature Fimbrial protein PapE
    Species: Escherichia coli [TaxId:562]
    Gene: papE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08407 (0-126)
      • modified residue (34)
      • modified residue (43)
    Domains in SCOPe 2.01: d1n0ld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0lA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkkekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0lA (A:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n0lB (B:)
    vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
    qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
    nliagpfsatatlvasys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0lB (B:)
    vpactvsnttvdwqdvengnhekeftvnmrcpynlgtmkvtitatntynnailvqssdgl
    lvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykpfsatatlvasys
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n0lC (C:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvkkekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0lC (C:)
    avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
    pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
    ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
    vksanyntpylsyindyggrpvlsficngsrcsvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n0lD (D:)
    vpactvsnttvdwqdveiqtlsqngnhekeftvnmrcpynlgtmkvtitatntynnailv
    qntsntssdgllvylynsnagnigtaitlgtpftpgkitgnnadktislhaklgykgnmq
    nliagpfsatatlvasys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0lD (D:)
    vpactvsnttvdwekeftvnmrcpynlgtmkvtitatntynnailvqgllvylynsnagn
    igtaitlgtpftpgkitgnnadktislhaklgykpfsatatlvasys