PDB entry 1n0j

View 1n0j on RCSB PDB site
Description: The Structure of Human Mitochondrial MN3+ Superoxide Dismutase Reveals a Novel Tetrameric Interface of Two 4-Helix Bundles
Class: oxidoreductase
Keywords: four-helix bundle, metalloenzyme, manganese, OXIDOREDUCTASE
Deposited on 2002-10-14, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0ja1, d1n0ja2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0jb1, d1n0jb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0jA (A:)
    mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia
    lqpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvq
    gsgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylka
    iwnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0jA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n0jB (B:)
    mkhslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqia
    lqpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvq
    gsgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylka
    iwnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0jB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk