PDB entry 1n0i

View 1n0i on RCSB PDB site
Description: Crystal Structure of Ferrochelatase with Cadmium bound at active site
Class: lyase
Keywords: pi-helix, lyase
Deposited on 2002-10-14, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0ia_
  • Heterogens: CD, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0iA (A:)
    msrkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqit
    eqqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstf
    svqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamliv
    sahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltr
    dlfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidal
    atvvlkklgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0iA (A:)
    srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
    qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
    vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
    ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
    lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
    tvvlkklgr