PDB entry 1n0h

View 1n0h on RCSB PDB site
Description: crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl
Deposited on 2002-10-14, released 2003-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-15, with a file datestamp of 2003-04-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.163
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0hA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0hA (A:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpstsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraq
    ipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskf
    apearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewf
    aqinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhw
    twrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagt
    pvkililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldak
    lkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n0hB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamgsapsfnvdpleqpa
    epsklakklraepdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdk
    fnfvlpkheqgaghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgq
    vptsaigtdafqeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlp
    kdvtaailrnpiptkttlpsnalnqltsraqdefvmqsinkaadlinlakkpvlyvgagi
    lnhadgprllkelsdraqipvtttlqglgsfdqedpksldmlgmhgcatanlavqnadli
    iavgarfddrvtgniskfapearraaaegrggiihfevspkninkvvqtqiavegdattn
    lgkmmskifpvkersewfaqinkwkkeypyaymeetpgskikpqtvikklskvandtgrh
    vivttgvgqhqmwaaqhwtwrnphtfitsgglgtmgyglpaaigaqvakpeslvididgd
    asfnmtltelssavqagtpvkililnneeqgmvtqwqslfyehryshthqlnpdfiklae
    amglkglrvkkqeeldaklkefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpe
    verqqtelrhkrtggkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0hB (B:)
    pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
    ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
    eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
    ptkttlpssraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqi
    pvtttlqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfa
    pearraaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfa
    qinkwkkeypyaymeetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwt
    wrnphtfitsgglgtmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtp
    vkililnneeqgmvtqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldakl
    kefvstkgpvllevevdkkvpvlpmvaggsgldefinfdpeverqqtelrhkrtggkh