PDB entry 1n0g

View 1n0g on RCSB PDB site
Description: Crystal Structure of A Cell Division and Cell Wall Biosynthesis Protein UPF0040 from Mycoplasma pneumoniae: Indication of A Novel Fold with A Possible New Conserved Sequence Motif
Class: biosynthetic protein
Keywords: Cell Division, cell wall biosynthesis protein, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, BIOSYNTHETIC PROTEIN
Deposited on 2002-10-13, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75467 (25-End)
      • expression tag (21-24)
    Domains in SCOPe 2.07: d1n0ga1, d1n0ga2
  • Chain 'B':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75467 (25-End)
      • expression tag (21-24)
    Domains in SCOPe 2.07: d1n0gb1, d1n0gb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0gA (A:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0gA (A:)
    fqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfn
    sfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwd
    kklyedylansesletvaerm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n0gB (B:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0gB (B:)
    fqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfn
    sfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwd
    kklyedylansesletvaerm