PDB entry 1n0e

View 1n0e on RCSB PDB site
Description: crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif
Class: biosynthetic protein
Keywords: Cell Division and cell wall biosynthesis protein, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, BIOSYNTHETIC PROTEIN
Deposited on 2002-10-13, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75467 (25-End)
      • expression tag (21-24)
    Domains in SCOPe 2.07: d1n0ea1, d1n0ea2
  • Chain 'B':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75467 (25-End)
      • expression tag (14-24)
    Domains in SCOPe 2.07: d1n0eb1, d1n0eb2
  • Chain 'C':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0ec_
  • Chain 'D':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0ed_
  • Chain 'E':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75467 (25-End)
      • expression tag (21-24)
    Domains in SCOPe 2.07: d1n0ee1, d1n0ee2
  • Chain 'F':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75467 (25-End)
      • expression tag (14-24)
    Domains in SCOPe 2.07: d1n0ef1, d1n0ef2
  • Chain 'G':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75467 (25-End)
      • expression tag (21-24)
    Domains in SCOPe 2.07: d1n0eg1, d1n0eg2
  • Chain 'H':
    Compound: Protein mraZ
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n0eh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n0eA (A:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eA (A:)
    fqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfn
    sfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwd
    kklyedylansesletvaerm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n0eB (B:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eB (B:)
    pttenlyfqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfq
    kyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqf
    dhleiwdkklyedylansesletvaerm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n0eC (C:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eC (C:)
    mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps
    tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly
    edylansesletvaerm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n0eD (D:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eD (D:)
    mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps
    tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly
    edylansesletvaerm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n0eE (E:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eE (E:)
    fqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfn
    sfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwd
    kklyedylansesletvaerm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n0eF (F:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eF (F:)
    pttenlyfqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfq
    kyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqf
    dhleiwdkklyedylansesletvaerm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1n0eG (G:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eG (G:)
    fqghmllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfn
    sfpstqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwd
    kklyedylansesletvaerm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1n0eH (H:)
    mgsshhhhhhdydipttenlyfqghmllgtfnitldaknrislpaklraffegsivinrg
    fenclevrkpqdfqkyfeqfnsfpstqkdtrtlkrlifananfvdvdtagrvlipnnlin
    dakldkeivligqfdhleiwdkklyedylansesletvaermkdvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n0eH (H:)
    mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps
    tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly
    edylansesletvaerm