PDB entry 1n04

View 1n04 on RCSB PDB site
Description: Diferric chicken serum transferrin at 2.8 A resolution.
Class: metal transport
Keywords: Iron transport, bilobal, METAL TRANSPORT
Deposited on 2002-10-11, released 2003-09-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum transferrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1n04a1, d1n04a2
  • Heterogens: FUL, FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n04A (A:)
    appksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisld
    ggqafeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglg
    rsagwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpkt
    kcarnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyk
    tcnwarvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpslmdsqlylgfeyysaiqsmrkdqltpsprenriqwcavgkdekskcdr
    wsvvsngdvectvvdetkdciikimkgeadavaldgglvytagvcglvpvmaeryddesq
    csktderpasyfavavarkdsnvnwnnlkgkkschtavgrtagwvipmglihnrtgtcnf
    deyfsegcapgsppnsrlcqlcqgsggippekcvasshekyfgytgalrclvekgdvafi
    qhstveentggknkadwaknlqmddfellctdgrranvmdyrecnlaevpthavvvrpek
    ankirdllerqekrfgvngsekskfmmfesqnkdllfkdltkclfkvregttykeflgdk
    fytvisslktcnpsdilqmcsflegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n04A (A:)
    ksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisldggq
    afeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglgrsa
    gwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpktkca
    rnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyktcn
    warvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllfkds
    aimlkrvpslmdsqlylgfeyysaiqsmrkdqltpsprenriqwcavgkdekskcdrwsv
    vsngdvectvvdetkdciikimkgeadavaldgglvytagvcglvpvmaeryddesqcsk
    tderpasyfavavarkdsnvnwnnlkgkkschtavgrtagwvipmglihnrtgtcnfdey
    fsegcapgsppnsrlcqlcqgsggippekcvasshekyfgytgalrclvekgdvafiqhs
    tveentggknkadwaknlqmddfellctdgrranvmdyrecnlaevpthavvvrpekank
    irdllerqekrfgvngsekskfmmfesqnkdllfkdltkclfkvregttykeflgdkfyt
    visslktcnpsdilqmcsflegk