PDB entry 1mzz

View 1mzz on RCSB PDB site
Description: crystal structure of mutant (m182t)of nitrite reductase
Deposited on 2002-10-10, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzzA (A:)
    vdlsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgs
    ipgplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkat
    ragafvyhcapggpmipwhvvsgtagcimvlprdglkdhegkpvrydtvyyigesdhyip
    kdedgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhs
    qpnrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnh
    nlieavhkgatahvlvegewdndlmeqvvapvgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzzB (B:)
    vdlsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgs
    ipgplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkat
    ragafvyhcapggpmipwhvvsgtagcimvlprdglkdhegkpvrydtvyyigesdhyip
    kdedgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhs
    qpnrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnh
    nlieavhkgatahvlvegewdndlmeqvvapvgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzzC (C:)
    vdlsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgs
    ipgplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkat
    ragafvyhcapggpmipwhvvsgtagcimvlprdglkdhegkpvrydtvyyigesdhyip
    kdedgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhs
    qpnrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnh
    nlieavhkgatahvlvegewdndlmeqvvapvgl