PDB entry 1mzz

View 1mzz on RCSB PDB site
Description: Crystal Structure of Mutant (M182T)of Nitrite Reductase
Class: oxidoreductase
Keywords: Nitrite reductase, crystal structure, mutant M182T, gating mechanism, electron transfer, OXIDOREDUCTASE
Deposited on 2002-10-10, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53239
      • engineered (143)
      • conflict (191)
      • conflict (242)
      • conflict (312)
      • conflict (328-329)
      • cloning artifact (333)
    Domains in SCOPe 2.07: d1mzza1, d1mzza2, d1mzza3
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53239
      • engineered (143)
      • conflict (191)
      • conflict (242)
      • conflict (312)
      • conflict (328-329)
      • cloning artifact (333)
    Domains in SCOPe 2.07: d1mzzb1, d1mzzb2, d1mzzb3
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53239 (0-332)
      • engineered (143)
      • conflict (191)
      • conflict (242)
      • conflict (312)
      • conflict (328-329)
      • cloning artifact (333)
    Domains in SCOPe 2.07: d1mzzc1, d1mzzc2, d1mzzc3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzzA (A:)
    vdlsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgs
    ipgplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkat
    ragafvyhcapggpmipwhvvsgtagcimvlprdglkdhegkpvrydtvyyigesdhyip
    kdedgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhs
    qpnrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnh
    nlieavhkgatahvlvegewdndlmeqvvapvgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzzB (B:)
    vdlsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgs
    ipgplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkat
    ragafvyhcapggpmipwhvvsgtagcimvlprdglkdhegkpvrydtvyyigesdhyip
    kdedgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhs
    qpnrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnh
    nlieavhkgatahvlvegewdndlmeqvvapvgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mzzC (C:)
    vdlsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgs
    ipgplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkat
    ragafvyhcapggpmipwhvvsgtagcimvlprdglkdhegkpvrydtvyyigesdhyip
    kdedgtymrfsdpsegyedmvavmdtlipshivfngavgaltgegalkakvgdnvlfvhs
    qpnrdsrphligghgdlvwetgkfhnaperdletwfirggtagaalykflqpgvyayvnh
    nlieavhkgatahvlvegewdndlmeqvvapvgl