PDB entry 1mzw

View 1mzw on RCSB PDB site
Description: Crystal structure of a U4/U6 snRNP complex between human spliceosomal cyclophilin H and a U4/U6-60K peptide
Class: isomerase
Keywords: cyclophilin, peptidyl-prolyl-cis/trans isomerase, spliceosome, snRNP, U4/U6-60K protein, WD protein
Deposited on 2002-10-10, released 2003-08-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U-snRNP-associated cyclophilin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1mzwa_
  • Chain 'B':
    Compound: U4/U6 snrnp 60kDa protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43172 (0-30)
      • conflict (4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mzwA (A:)
    mavansspvnpvvffdvsiggqevgrmkielfadvvpktaenfrqfctgefrkdgvpigy
    kgstfhrvikdfmiqggdfvngdgtgvasiyrgpfadenfklrhsapgllsmansgpstn
    gcqffitcskcdwldgkhvvfgkiidgllvmrkienvptgpnnkpklpvvisqcgem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mzwA (A:)
    nsspvnpvvffdvsiggqevgrmkielfadvvpktaenfrqfctgefrkdgvpigykgst
    fhrvikdfmiqggdfvngdgtgvasiyrgpfadenfklrhsapgllsmansgpstngcqf
    fitcskcdwldgkhvvfgkiidgllvmrkienvptgpnnkpklpvvisqcgem
    

  • Chain 'B':
    No sequence available.